HPA005661

ADAMTS5 antibody from Sigma-Aldrich
ADAMTS11, ADMP-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005661, RRID:AB_1078101
Product name
Anti-ADAMTS5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005661
Antibody type
Polyclonal
Antigen
A disintegrin and metalloproteinase with thrombospondin motifs 5 precursor (ADAMTS-5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAMTS-11)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERD
GSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSP
RSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAE
EEKGRVYGDGS
Storage
-20C
Provider Type Product Number
- No reagents -