HPA019560

KIAA1549 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019560
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019560, RRID:AB_1852418
Product name
Anti-KIAA1549 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019560
Antibody type
Polyclonal
Antigen
UPF0606 protein KIAA1549
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNGSEVSELLRNLSVVEFSFYLGYPVLQIAEPFQY
PQLNLSQLLKSSWVRTVLLGVMEKQLQNEVFQAEM
ERKLAQLLSEVSTRRRMWRRATVAAGNSVVQVVNV
SRLEGDDNPVQLIYFVEDQDGERLSA
Storage
-20C
Provider Type Product Number
- No reagents -