HPA016645

CNTN6 antibody from Sigma-Aldrich
NB-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016645
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016645, RRID:AB_1847149
Product name
Anti-CNTN6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016645
Antibody type
Polyclonal
Antigen
Contactin-6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWK
QNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMY
QCLATNLLGTILSRKAKLQF
Storage
-20C
Provider Type Product Number
- No reagents -