HPA001565

SERPINI1 antibody from Atlas Antibodies
PI12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001565
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001565, RRID:AB_1079924
Product name
Anti-SERPINI1
Provider product page
Atlas Antibodies - HPA001565
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVL
EIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVE
EWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -