HPA001565

SERPINI1 antibody from Sigma-Aldrich
neuroserpin, PI12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001565, RRID:AB_1079924
Product name
Anti-SERPINI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001565
Antibody type
Polyclonal
Antigen
Neuroserpin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVL
EIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVE
EWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGI
Storage
-20C
Provider Type Product Number
- No reagents -