H00007565-B01P

ZNF17 antibody from Abnova Corporation
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10
No application information provided.

Antibody data

Product number
H00007565-B01P
Provider
Abnova Corporation
Product name
ZNF17 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00007565-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF17 protein.
Antigen sequence
MNLTEDYMVFEDVAIHFSQEEWGILNDVQRHLHSD
VMLENFALLSSVGCWHGAKDEEAPSKQCVSVGVSQ
VTTLKPALSTQKAQPCETCSSLLKDILHLAEHDGT
HPKRTAKLYLHQKEHLREKLTRSDEGRPSFVNDSV
HLAKRNLTCMQGGKDFTGDSDLQQQALHSGWKPHR
DTHGVEAFQSGQNNYSCTQCGKDFCHQHTLFEHQK
IHTEERPYECSECGKLFRYNSDLIKHQRNHTGERP
YKCSECGKAFSLKYNVVQHQKIHTGERPYECSECG
KAFLRKSHLLQHQRIHTRPRPYVCSECGKAFLTQA
HLVGHQKIHTGERPYGCNECGKYFMYSSALIRHQK
VHTGERPFYCCECGKFFMDSCTLIIHQRVHTGEKP
YECNECGKFFRYRSTLIRHQKVHTGEKPYECSECG
KFFMDTSTLIIHQRVHTGEKPYECNKCGKFFRYCF
TLNRHQRVHSGERPYECSECGKFFVDSCTLKSHQR
VHTGERPFECSICGKSFRCRSTLDTHQRIHTGERP
YECSECGKFFRHNSNHIRHRRNHFGERSFECTECG
RVFSQNSHLIRHQKVHTRERTYKCSKCGKFFMDSS
TLISHERVHTGEKPYECSECGKVFRYNSSLIKHRR
IHTGERPYQCSECGRVFNQNSHLIQHQKVHTR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -