AV36291

ZNF17 antibody from MilliporeSigma / Merck KGaA
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10
No application information provided.

Antibody data

Product number
AV36291
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF17 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV36291
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF17 with an internal ID of P07650
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGV
EAFQSGQNNYSCTQC
Storage
-20C