AV38886

ZNF17 antibody from Sigma-Aldrich
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10
No application information provided.

Antibody data

Product number
AV38886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV38886, RRID:AB_1859098
Product name
Anti-ZNF17 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV38886
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF17 with an internal ID of P21092
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDV
MLENFALLSSVGCWH
Storage
-20C
Provider Type Product Number
- No reagents -