Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28576 - Provider product page
- Provider
- Abnova Corporation
- Product name
- IFI16 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant IFI16.
- Antigen sequence
KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNA
DRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGV
FEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTI
NCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKV
IK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of HEK293T cell lysate using IFI16 polyclonal antibody (Cat # PAB28576).Lane 1: Negative control (vector only)Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U-251 MG cell line with IFI16 polyclonal antibody (Cat # PAB28576) shows positivity in nucleus and nucleoli. Fixation/Permeabilization: PFA/Triton X-104
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human skin with IFI16 polyclonal antibody (Cat # PAB28576) shows strong nuclear positivity in epidermal cells. Retrieval method: HIER pH6
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)