Antibody data

Product number
H00003428-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003428-M02A, RRID:AB_1576163
Product name
IFI16 monoclonal antibody (M02A), clone 2C2
Provider product page
Abnova Corporation - H00003428-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant IFI16.
Antigen sequence
FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHG
RLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIH
SHIKVIKTRKNKKDILNPDSSMETSPDFFF
Isotype
IgG
Antibody clone number
2C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -