HPA002134

IFI16 antibody from Sigma-Aldrich
IFNGIP1, PYHIN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002134, RRID:AB_1079099
Product name
Anti-IFI16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002134
Antibody type
Polyclonal
Antigen
gamma-Interferon-inducible protein Ifi-16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNA
DRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGV
FEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTI
NCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKV
IK
Storage
-20C
Provider Type Product Number
- No reagents -