HPA019743

UBN2 antibody from Sigma-Aldrich
FLJ25778, KIAA2030
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019743
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019743, RRID:AB_1848851
Product name
Anti-UBN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019743
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA2030 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTD
TAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHA
ATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS
Storage
-20C
Provider Type Product Number
- No reagents -