HPA020122

UBN2 antibody from MilliporeSigma / Merck KGaA
FLJ25778, KIAA2030
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020122
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020122, RRID:AB_1848847
Product name
Anti-UBN2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020122
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA2030 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DASSLTQVTKVHQHSAVQQNYVSPLQATISKSQTN
PVVKLSNNPQLSCSSSLIKTSDKPLMYRLPLSTPS
PGNGSQGSHPLVSRTVPSTTT
Storage
-20C
Provider Type Product Number
- No reagents -