HPA025241

KNTC1 antibody from Sigma-Aldrich
KIAA0166, ROD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025241
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025241, RRID:AB_1852629
Product name
Anti-KNTC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025241
Antibody type
Polyclonal
Antigen
Kinetochore-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRT
VPEGQIILAKWLEQAARNLELTDKANWPENGLQLA
EIFFTAEKTDELGLASSWHWISLKDYQNTEEVCQL
RTLVNNLR
Storage
-20C
Provider Type Product Number
- No reagents -