Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 103-PA49AG - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- Endomucin
- Antibody type
- Polyclonal
- Antigen
- Recombinant mouse soluble Endomucin
- Description
- antibody affinity purified from serum
- Reactivity
- Mouse
- Host
- Rabbit
- Antigen sequence
EDGKDVQNDSIPTPAETSTTKASVTIPGIVSVTNP
NKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHE
VGTTTEGPLRNESSTMKITVPNTPTSNANSTLPGS
QNKTENQSSIRTTEISVTTQLLDALPKITATSSAS
LTTAHTMSLLQDTEDRKIATTPSTTPSYSSTRHHH
HHH- Antibody clone number
- Rabbit IG
- Vial size
- 50 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western Analysis of anti-mouse Endomucin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions. Lane 1: MWM (kDa); lane 2: rm sEndomucin (250ng).
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunofluorescence staining (green) of cryo-sections of adult mouse kidney (fixed 15 min in 4% PFA) with anti-mouse Endomucin (5µg/ml) [Cat# 103-PA49AG] and counter staining of nuclei with Dapi. The experiment was performed by the research group of Prof. Dr. J. Wilting and Dr. K. Buttler, University Göttingen, Germany.
- Sample type
- Mouse kidney