H00026257-B01P

NKX2-8 antibody from Abnova Corporation
Nkx2-9, NKX2.8, NKX2H

Antibody data

Product number
H00026257-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026257-B01P, RRID:AB_1578058
Product name
NKX2-8 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026257-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NKX2-8 protein.
Antigen sequence
MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAP
QPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRP
SARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQ
QRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLK
RARAPGAAESPDLAASAELHAAPGLLRRVVVPVLV
RDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPG
YPAFGPGSALGLFPAYQHLASPALVSWNW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -