Antibody data

Product number
H00005083-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005083-M13, RRID:AB_1578454
Product name
PAX9 monoclonal antibody (M13), clone 3B8
Provider product page
Abnova Corporation - H00005083-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PAX9.
Antigen sequence
RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPH
AVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSM
APYPTPAQVSPYMTYSAAPSGYVAGH
Isotype
IgG
Antibody clone number
3B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -