Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29330 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CUL5 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human CUL5.
- Antigen sequence
FSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAE
TITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFL
TARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPE
SKCPELLANYCDMLLRK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4; Lane 2: Human cell line U-251MG sp with CUL5 polyclonal antibody (Cat# PAB29330) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with CUL5 polyclonal antibody (Cat# PAB29330) under 1-4 ug/mL working concentration shows positivity in the Golgi apparatus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon with CUL5 polyclonal antibody (Cat# PAB29330) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)