HPA002185

CUL5 antibody from Sigma-Aldrich
VACM-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002185
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002185, RRID:AB_1078587
Product name
Anti-CUL5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002185
Antibody type
Polyclonal
Antigen
Cullin-5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAE
TITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFL
TARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPE
SKCPELLANYCDMLLRK
Storage
-20C
Provider Type Product Number
- No reagents -