HPA021068

CNTN4 antibody from MilliporeSigma / Merck KGaA
BIG-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021068
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021068, RRID:AB_1847148
Product name
Anti-CNTN4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021068
Antibody type
Polyclonal
Antigen
Contactin-4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSV
IAVGPDFSRTLLKRVTLVKVGGEVVIECKPKASPK
PVYTWKKGRDILKENERITISEDGNLRIIN
Storage
-20C
Provider Type Product Number
- No reagents -