HPA026817

PCDH17 antibody from Sigma-Aldrich
PCDH68, PCH68
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026817, RRID:AB_1855044
Product name
Anti-PCDH17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026817
Antibody type
Polyclonal
Antigen
Protocadherin-17 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTV
RALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEI
RTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLI
IRSVSGSLPEGVPRVNGEQHHWD
Storage
-20C
Provider Type Product Number
- No reagents -