HPA005822

CHRNB1 antibody from MilliporeSigma / Merck KGaA
CHRNB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005822
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005822, RRID:AB_1079484
Product name
Anti-CHRNB1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005822
Antibody type
Polyclonal
Antigen
Acetylcholine receptor subunit beta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLR
LKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRK
PPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVAL
LPELREVVSSISYIARQLQEQEDHDALKEDWQF
Storage
-20C
Provider Type Product Number
- No reagents -