Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028996-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028996-M01, RRID:AB_565829
- Product name
- HIPK2 monoclonal antibody (M01), clone 4F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIPK2.
- Antigen sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHS
SSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGP
HFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT- Isotype
- IgG
- Antibody clone number
- 4F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references High-mobility group A1 proteins regulate p53-mediated transcription of Bcl-2 gene.
Esposito F, Tornincasa M, Chieffi P, De Martino I, Pierantoni GM, Fusco A
Cancer research 2010 Jul 1;70(13):5379-88
Cancer research 2010 Jul 1;70(13):5379-88
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in human ovarian cancer.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in H9c2(2-1).