Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [2]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00028996-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00028996-M01, RRID:AB_565829
 - Product name
 - HIPK2 monoclonal antibody (M01), clone 4F4
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant HIPK2.
 - Antigen sequence
 TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHS
SSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGP
HFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT- Isotype
 - IgG
 - Antibody clone number
 - 4F4
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		High-mobility group A1 proteins regulate p53-mediated transcription of Bcl-2 gene.
				
		
	
			Esposito F, Tornincasa M, Chieffi P, De Martino I, Pierantoni GM, Fusco A
Cancer research 2010 Jul 1;70(13):5379-88
		Cancer research 2010 Jul 1;70(13):5379-88
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in human ovarian cancer.
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in H9c2(2-1).