Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [2]
 - ELISA [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00028996-M03 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00028996-M03, RRID:AB_565832
 - Product name
 - HIPK2 monoclonal antibody (M03), clone 1F10
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant HIPK2.
 - Antigen sequence
 TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHS
SSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGP
HFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT- Isotype
 - IgG
 - Antibody clone number
 - 1F10
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol