Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028996-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028996-M03, RRID:AB_565832
- Product name
- HIPK2 monoclonal antibody (M03), clone 1F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIPK2.
- Antigen sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHS
SSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGP
HFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT- Isotype
- IgG
- Antibody clone number
- 1F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol