Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028996-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028996-M06, RRID:AB_565827
- Product name
- HIPK2 monoclonal antibody (M06), clone 4E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIPK2.
- Antigen sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHS
SSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGP
HFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT- Isotype
- IgG
- Antibody clone number
- 4E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in human ovarian cancer.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in RIN-m5F.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HIPK2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol