HPA007611

HIPK2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007611
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007611, RRID:AB_1850730
Product name
Anti-HIPK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007611
Antibody type
Polyclonal
Antigen
Homeodomain-interacting protein kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSH
SKVYSQSKNIPLSQPATTTVSTSLPVPNPSLPYEQ
TIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRR
STVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPP
Storage
-20C
Provider Type Product Number
- No reagents -