Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109570 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 274 (ZNF274) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF274 antibody: synthetic peptide directed towards the N terminal of human ZNF274
- Description
- Purified on Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
YPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVA
GPRNAQIQALYAEDG- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Identification and characterization of human ZNF274 cDNA, which encodes a novel kruppel-type zinc-finger protein having nucleolar targeting ability.
Yano K, Ueki N, Oda T, Seki N, Masuho Y, Muramatsu M
Genomics 2000 Apr 1;65(1):75-80
Genomics 2000 Apr 1;65(1):75-80
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-ZNF274 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; ZNF274 antibody - N-terminal region (AP42037PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Heart; ZNF274 antibody - N-terminal region (AP42037PU-N) in Human Heart cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human kidney; ZNF274 antibody - N-terminal region (AP42037PU-N) in Human kidney cells using Immunohistochemistry