HPA005964

PARVA antibody from Sigma-Aldrich
FLJ10793, FLJ12254, MXRA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005964
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005964, RRID:AB_1079569
Product name
Anti-PARVA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005964
Antibody type
Polyclonal
Antigen
alpha-Parvin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMV
DPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDL
AEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQK
QKLQTVLEKINETLKLP
Storage
-20C
Provider Type Product Number
- No reagents -