HPA022526

PGS1 antibody from Sigma-Aldrich
DKFZP762M186
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022526
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022526, RRID:AB_1855271
Product name
Anti-PGS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022526
Antibody type
Polyclonal
Antigen
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRVSLFHTPHLRGLLRLLIPERFNETIGLQHIKVY
LFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIA
DFFTELVDAVGDVSLQLQGDDTVQVVDGMVHPYKG
DRAEYCKAANKRVMDVINSA
Storage
-20C
Provider Type Product Number
- No reagents -