HPA027833

RXFP3 antibody from Atlas Antibodies
GPCR135, RLN3R1, RXFPR3, SALPR

Antibody data

Product number
HPA027833
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027833, RRID:AB_1849247
Product name
Anti-RXFP3
Provider product page
Atlas Antibodies - HPA027833
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAA
NTSGNASLQLPDLWWELGLELPDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.