HPA027833

RXFP3 antibody from Sigma-Aldrich
GPCR135, RLN3R1, RXFPR3, SALPR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027833
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027833, RRID:AB_1849247
Product name
Anti-RXFP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027833
Antibody type
Polyclonal
Antigen
Relaxin-3 receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAA
NTSGNASLQLPDLWWELGLELPDG
Storage
-20C
Provider Type Product Number
- No reagents -