Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28577 - Provider product page 
- Provider
- Abnova Corporation
- Product name
- FABP4 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant FABP4.
- Antigen sequence
- DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMA
 KPNMIISVNGDVITIKSESTFKNTEISFILGQEFD
 EVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKR
 KREDDKLVVECVMKGVTSTRVYE
- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western blot analysis of RT-4 cell lysates using FABP4 polyclonal antibody (Cat # PAB28577).
- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western blot analysis of lane 1: NIH-3T3 and lane 2: NBT-II cell lysates using FABP4 polyclonal antibody (Cat # PAB28577).
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescence of A-431 cell line with FABP4 polyclonal antibody (Cat # PAB28577) shows positivity in cytoplasm. Fixation/Permeabilization: PFA/Triton X-105
- Validation comment
- Immunofluorescence
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human soft tissue with FABP4 polyclonal antibody (Cat # PAB28577) shows distinct positivity in adipocytes. Retrieval method: HIER pH6
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)