Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487115 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Fatty Acid Binding Protein 4, Adipocyte (FABP4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTI
KRKRE DDKLVVECVM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Serum levels of the adipokine adipocyte fatty acid-binding protein are increased in preeclampsia.
Fasshauer M, Seeger J, Waldeyer T, Schrey S, Ebert T, Kratzsch J, Lössner U, Blüher M, Stumvoll M, Faber R, Stepan H
American journal of hypertension 2008 May;21(5):582-6
American journal of hypertension 2008 May;21(5):582-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting