HPA002188

FABP4 antibody from Atlas Antibodies
A-FABP, aP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002188
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002188, RRID:AB_888388
Product name
Anti-FABP4
Provider product page
Atlas Antibodies - HPA002188
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMA
KPNMIISVNGDVITIKSESTFKNTEISFILGQEFD
EVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKR
KREDDKLVVECVMKGVTSTRVYE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -