HPA002188

FABP4 antibody from Sigma-Aldrich
A-FABP, aP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002188
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002188, RRID:AB_1078822
Product name
Anti-FABP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002188
Antibody type
Polyclonal
Antigen
Fatty acid-binding protein, adipocyte recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMA
KPNMIISVNGDVITIKSESTFKNTEISFILGQEFD
EVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKR
KREDDKLVVECVMKGVTSTRVYE
Storage
-20C
Provider Type Product Number
- No reagents -