HPA002475

antibody from Atlas Antibodies

Targeting: RPH3A exophilin-1, KIAA0985, rabphilin

Antibody data

Submit

Validation data

Product number: HPA002475 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002475, RRID:AB_1079837
Product name: Anti-RPH3A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTP GGSRPGPGPAGRFPDQKPEVAPSDPGTTAPPREER TGGVGGYPAVGAREDRMSHPSGPYSQASAAAPQPA AARQPPPPEEEEEEANSYDSDEATTLGALEFSLLY DQDNS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RPH3A protein structure - HPA002475 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA002475 antibody. Corresponding RPH3A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in purkinje cells and cells of molecular layer.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Sample type: HUMAN