HPA002475

RPH3A antibody from Atlas Antibodies
exophilin-1, KIAA0985, rabphilin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002475
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002475, RRID:AB_1079837
Product name
Anti-RPH3A
Provider product page
Atlas Antibodies - HPA002475
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTP
GGSRPGPGPAGRFPDQKPEVAPSDPGTTAPPREER
TGGVGGYPAVGAREDRMSHPSGPYSQASAAAPQPA
AARQPPPPEEEEEEANSYDSDEATTLGALEFSLLY
DQDNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -