HPA002475

RPH3A antibody from Sigma-Aldrich
exophilin-1, KIAA0985, rabphilin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002475
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002475, RRID:AB_1079837
Product name
Anti-RPH3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002475
Antibody type
Polyclonal
Antigen
Rabphilin-3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTP
GGSRPGPGPAGRFPDQKPEVAPSDPGTTAPPREER
TGGVGGYPAVGAREDRMSHPSGPYSQASAAAPQPA
AARQPPPPEEEEEEANSYDSDEATTLGALEFSLLY
DQDNS
Storage
-20C
Provider Type Product Number
- No reagents -