Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183096 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Heat Shock Transcription Factor 2 Binding Protein (HSF2BP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRIL
NGEVL ESFQKLKIVE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel testis-specific protein that interacts with heat shock factor 2.
Preferential transfection with M13mp2 RF DNA synthesized in vitro.
Yoshima T, Yura T, Yanagi H
Gene 1998 Jul 3;214(1-2):139-46
Gene 1998 Jul 3;214(1-2):139-46
Preferential transfection with M13mp2 RF DNA synthesized in vitro.
Hayes RC, LeClerc JE
Gene 1983 Jan-Feb;21(1-2):1-8
Gene 1983 Jan-Feb;21(1-2):1-8
No comments: Submit comment
No validations: Submit validation data