HPA002196

IGFBP7 antibody from Sigma-Aldrich
FSTL2, IGFBP-7, MAC25, PSF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002196
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002196, RRID:AB_1079107
Product name
Anti-IGFBP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002196
Antibody type
Polyclonal
Antigen
Insulin-like growth factor-binding protein 7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVL
IWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEK
HEVTGWVLVSPLSKEDAGEYECHASNSQGQA
Storage
-20C
Provider Type Product Number
- No reagents -