HPA021551

ENGASE antibody from Atlas Antibodies
FLJ21865
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021551
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021551, RRID:AB_1848156
Product name
Anti-ENGASE
Provider product page
Atlas Antibodies - HPA021551
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEP
LACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSV
VQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTA
HR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -