HPA021551

ENGASE antibody from Sigma-Aldrich
FLJ21865
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021551
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021551, RRID:AB_1848156
Product name
Anti-ENGASE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021551
Antibody type
Polyclonal
Antigen
Cytosolic endo-beta-N-acetylglucosaminidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEP
LACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSV
VQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTA
HR
Storage
-20C
Provider Type Product Number
- No reagents -