HPA020324

RRP1B antibody from Atlas Antibodies
KIAA0179, Nnp1, PPP1R136, RRP1

Antibody data

Product number
HPA020324
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020324, RRID:AB_1852276
Product name
Anti-RRP1B
Provider product page
Atlas Antibodies - HPA020324
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKF
DTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSS
SKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAF
DPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.