PAB21260

RRP1B antibody from Abnova Corporation
KIAA0179, Nnp1, PPP1R136, RRP1

Antibody data

Product number
PAB21260
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21260, RRID:AB_10963902
Product name
RRP1B polyclonal antibody
Provider product page
Abnova Corporation - PAB21260
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RRP1B.
Antigen sequence
VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKF
DTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSS
SKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAF
DPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.