HPA020324

RRP1B antibody from Sigma-Aldrich
KIAA0179, Nnp1, PPP1R136, RRP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020324
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020324, RRID:AB_1852276
Product name
Anti-KIAA0179 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020324
Antibody type
Polyclonal
Antigen
Ribosomal RNA processing protein 1 homolog B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKF
DTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSS
SKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAF
DPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
Storage
-20C
Provider Type Product Number
- No reagents -