HPA021196

KLHL1 antibody from Sigma-Aldrich
FLJ30047, KIAA1490, MRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021196
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021196, RRID:AB_1852567
Product name
Anti-KLHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021196
Antibody type
Polyclonal
Antigen
Kelch-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTL
FYVESLEEEVVPGMDFPGPHEKGLVLQELKV
Storage
-20C
Provider Type Product Number
- No reagents -