HPA014662

SLC25A22 antibody from Sigma-Aldrich
EIEE3, FLJ13044, GC1, NET44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014662
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014662, RRID:AB_10600808
Product name
Anti-SLC25A22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014662
Antibody type
Polyclonal
Antigen
solute carrier family 25 (mitochondrial carrier: glutamate), member 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRH
QLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEML
KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Storage
-20C
Provider Type Product Number
- No reagents -