HPA022974

CCDC40 antibody from Atlas Antibodies
CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022974
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022974, RRID:AB_1848791
Product name
Anti-CCDC40
Provider product page
Atlas Antibodies - HPA022974
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHP
EEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGD
AESEEEYYYTETSSPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -