PAB30349

AGTR1 antibody from Abnova Corporation
AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT2R1, AT2R1A, AT2R1B, HAT1R
No application information provided.

Antibody data

Product number
PAB30349
Provider
Abnova Corporation
Product name
AGTR1 polyclonal antibody
Provider product page
Abnova Corporation - PAB30349
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant human AGTR1.
Antigen sequence
LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSS
TKKP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -