HPA003596

AGTR1 antibody from Sigma-Aldrich
AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT2R1, AT2R1A, AT2R1B, HAT1R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003596
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003596, RRID:AB_1845163
Product name
Anti-AGTR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003596
Antibody type
Polyclonal
Antigen
Type-1 angiotensin II receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSS
TKKP
Storage
-20C
Provider Type Product Number
- No reagents -