HPA003221

RPS6KA3 antibody from Atlas Antibodies
CLS, HU-3, MRX19, RSK2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003221
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003221, RRID:AB_1853553
Product name
Anti-RPS6KA3
Provider product page
Atlas Antibodies - HPA003221
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGE
EEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKA
TLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE
GKLY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -